l37 complex 1 mg

LL-37 Complex (1mg)

$113.00

LL-37, a member of the cathelicidin family, stands out as the only known human cathelicidin, which is a diverse protein family renowned for its antimicrobial properties. This peptide, primarily located in macrophages and polymorphonuclear leukocytes, crucial white blood cell types, exhibits multifaceted functions, including antimicrobial, antibacterial, antiviral, and anti-fungal activities. Beyond its role in combating infections, LL-37 has been recognized for its anti-inflammatory properties, contributing to the regulation of immune responses.

Recent research has expanded our understanding of LL-37’s impact, revealing its potential against certain cancers. The peptide has demonstrated anticancer effects, suggesting a promising avenue for therapeutic intervention. Additionally, LL-37 has been implicated in promoting blood vessel growth in specific contexts, showcasing its involvement in processes crucial for tissue repair and regeneration. The broad spectrum of LL-37’s functions underscores its significance not only in the immune system’s defense against pathogens but also in influencing diverse physiological processes, ranging from autoimmune diseases to wound healing.

Categories: ,

Description

What is LL-37 Complex (1mg)?

LL-37, a member of the cathelicidin family, stands out as the only known human cathelicidin, which is a diverse protein family renowned for its antimicrobial properties. This peptide, primarily located in macrophages and polymorphonuclear leukocytes, crucial white blood cell types, exhibits multifaceted functions, including antimicrobial, antibacterial, antiviral, and anti-fungal activities. Beyond its role in combating infections, LL-37 has been recognized for its anti-inflammatory properties, contributing to the regulation of immune responses.

Recent research has expanded our understanding of LL-37’s impact, revealing its potential against certain cancers. The peptide has demonstrated anticancer effects, suggesting a promising avenue for therapeutic intervention. Additionally, LL-37 has been implicated in promoting blood vessel growth in specific contexts, showcasing its involvement in processes crucial for tissue repair and regeneration. The broad spectrum of LL-37’s functions underscores its significance not only in the immune system’s defense against pathogens but also in influencing diverse physiological processes, ranging from autoimmune diseases to wound healing.

Chemical Structure of LL-37 Complex (1mg)?

The chemical structure of LL-37 is that of a cathelicidin peptide, a type of antimicrobial peptide. The specific amino acid sequence of LL-37 is as follows:

[LL-37, 37 aa]

This sequence represents the primary structure of LL-37, where each letter corresponds to a specific amino acid. LL-37 is a relatively short peptide consisting of 37 amino acids and is known for its diverse functions, including antimicrobial, anti-inflammatory, and potential roles in cancer and wound healing.

What Are the Effects of LL-37 Complex (1mg)?

Antimicrobial Properties

LL-37, as a member of the cathelicidin family, exhibits potent antimicrobial effects. It serves as a natural defense mechanism against various microorganisms, including bacteria, viruses, and fungi. LL-37’s ability to disrupt the integrity of microbial cell membranes contributes to its effectiveness in combating a broad spectrum of pathogens.

Antibacterial Actions

LL-37 demonstrates specific antibacterial activity, targeting various bacterial strains. Its capacity to interact with bacterial membranes and disrupt cellular functions makes it a valuable component in the body’s defense against bacterial infections.

Antiviral Characteristics

LL-37 also exhibits antiviral properties, playing a role in the body’s defense against viral infections. Its mechanisms involve interference with viral entry and replication, contributing to the overall antiviral defense system.

Anti-fungal Effects

In addition to its antimicrobial actions, LL-37 has antifungal properties, making it effective against certain fungal pathogens. It contributes to the prevention and control of fungal infections by disrupting fungal cell membranes and functions.

Anti-inflammatory Functions

LL-37 serves as an anti-inflammatory agent, participating in the regulation of the immune response. By modulating inflammatory processes, LL-37 helps maintain a balanced immune system and contributes to the resolution of inflammation associated with various conditions.

These multifaceted effects highlight LL-37’s crucial role in the innate immune system, providing protection against a diverse range of microbial threats and contributing to overall immune homeostasis.

Reviews

There are no reviews yet.

Be the first to review “LL-37 Complex (1mg)”

Your email address will not be published. Required fields are marked *

Related Products